Genome Channel Computational Biosciences
HomeAbout UsAnalysis ToolsInformation ResourcesProjects and Research
[space] Gene Channel Generation Microbial Gene Prediction System Grail (Microbial Gene Prediction System Internet Link) GrailEXP Genome Analysis Pipeline DomainParser PROSPECT (PROtein Structure Prediction and Evaluation Computer Toolkit) [space]
-

Mesorhizobium sp. BNC1 analysis files

Produced for the Joint Genome Institute Microbial Sequencing program.
N.B.: These pages subject to frequent change - work in progress.


Version 05apr06 - Contig1436 Gene Meso0396

Gene Location

Strand = r
Location = 435026..436183

PROTEIN

Protein Length = 385

MTAAKRAGAFLTVDLEAVTANWLLLAGRAAGAECAAVVKADAYGLGAAEVATALQDAGCRTFFVAHLEEGLSLRRTLGSG
SRIFVLNGTPPDTQEEFGQAALTPVVGTINELQAWRKHAATKRGPIPVALQLDTGMSRLGLSPSDVSGIAADTTLLRGIH
IELVMSHLACADEPGHSANESQRSRFQRLRRMLPQAPASIANSSGTFLGKGFHFSMIRPGAALYGINPTPYQPNPMCQVV
KVAARVLQVRQARAGTGIGYGHAARARRLSMLATIALGYADGWPCQASGAAYYRGQRLPFIGRVSMDSIILDVTGCSNPP
REGDLVEFICPSQTVDEIGRLAGSIGYEVLTRLGRRFHRRYIRPNISPAQSTRSGSPLLADDTAE

Best Blast vs NR Hit

Name Evalue Percent Identity
putative alanine racemase, catabolic [Gluconacetobacter diazotrophicus PAl 5] ref|YP_002275078.1| alanine racemase [Gluconacetobacter diazotrophicus PAl 5] emb|CAP56364.1| putative alanine racemase, catabolic [Gluconacetobacter -TRUNCATED- 6e-96 50
Refresh BLAST results

Best Blast vs SwissProt/TREMBL Hit

Name Evalue Percent Identity
Q11LC5 Alanine racemase 0.0 100
Refresh BLAST results

COGS Comparison

Group COG ID COG Name Top Hit Score Evalue
M COG0787 Alanine racemase Alr 360 8e-101
All genes with COG0787

Best KEGG Hit

Name Evalue Percent Identity
alanine racemase ; K01775 alanine racemase [EC:5.1.1.1] 1e-104 55

PRIAM EC Number Assignment and Map

Evalue EC Number
2e-89 5.1.1.1
Pathway(s) Map Number
None

InterPro


GENE Meso0396 Length=385
Alanine racemase region (IPR000821) [All genes with IPR000821]
PR00992ALARACEMASE
(7.3e-37)
FPrintScan
Alanine racemase, C-terminal (IPR011079) [All genes with IPR011079]
PF00842Ala_racemase_C
(2.3e-54)
HMMPfam
Alanine racemase, N-terminal (IPR001608) [All genes with IPR001608]
PF01168Ala_racemase_N
(1.3e-70)
HMMPfam
Alanine racemase region (IPR000821) [All genes with IPR000821]
PS00395ALANINE_RACEMASE
(0.0e+00)
ProfileScan
PS00395ALANINE_RACEMASE
(8.0e-05)
ScanRegExp
TIGR00492alr
(6.5e-61)
HMMTigr

Transmembrane TMHMM 2.0

Source http://www.cbs.dtu.dk/services/TMHMM/

SignalP 3.0

Source http://www.cbs.dtu.dk/services/SignalP/

-
SiteMap      Feedback      Biosciences Division      ORNL     Disclaimer     Webmaster