Genome Channel Computational Biosciences
HomeAbout UsAnalysis ToolsInformation ResourcesProjects and Research
[space] Gene Channel Generation Microbial Gene Prediction System Grail (Microbial Gene Prediction System Internet Link) GrailEXP Genome Analysis Pipeline DomainParser PROSPECT (PROtein Structure Prediction and Evaluation Computer Toolkit) [space]
-

Desulfovibrio desulfuricans G20 analysis files

Produced for the Joint Genome Institute Microbial Sequencing program.
N.B.: These pages subject to frequent change - work in progress.


Version 15nov10 - Contig143 Gene Dde_3004

Gene Location

Strand = f
Location = 2990103..2990864

PROTEIN

Protein Length = 253

MYKLVLVRHGQSTWNLENRFTGWTDVDLTPLGETEAREGARLIAAAGLTFDECHTSVLKRAIRTLNIIQEELDLLWLPVH
RHWRLNERHYGALQGLNKKEMSEKYGEEQVFIWRRSFDTPPPALTADDPRHPAHDRRYASLTARQMPLCESLKDTVARVL
PYWHETLAPAIQAGRRLLVAAHGNSLRALVMHLDGMSPDEVTGLNIPTGLPLVYELDSNLTPLRRAYLGDAEAAEAKARA
VAEQAKAGTTERP

Best Blast vs NR Hit

Name Evalue Percent Identity
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [Curvibacter putative symbiont of Hydra magnipapillata] 1e-91 65
Refresh BLAST results

Best Blast vs SwissProt/TREMBL Hit

Name Evalue Percent Identity
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; 1e-145 100
Refresh BLAST results

COGS Comparison

Group COG ID COG Name Top Hit Score Evalue
G COG0588 Phosphoglycerate mutase 1 GpmA 350 4e-98
G COG0406 Fructose-2 6-bisphosphatase phoE 108 3e-25
All genes with COG0406

Best KEGG Hit

Name Evalue Percent Identity
gpmA; phosphoglyceromutase 3e-99 70

PRIAM EC Number Assignment and Map

Evalue EC Number
7e-92 5.4.2.4
Pathway(s) Map Number
Bisphosphoglycerate mutase. map00010
Bisphosphoglycerate mutase. map01061

InterPro


GENE Dde_3004 Length=253
Phosphoglycerate mutase (IPR013078) [All genes with IPR013078]
PF00300PGAM
(1.1e-31)
HMMPfam
Phosphoglycerate/bisphosphoglycerate mutase, active site (IPR001345) [All genes with IPR001345]
PS00175PG_MUTASE
(0.0e+00)
PatternScan
Phosphoglycerate mutase (IPR013078) [All genes with IPR013078]
SM00855PGAM
(1.6e-23)
HMMSmart
Phosphoglycerate mutase 1 (IPR005952) [All genes with IPR005952]
TIGR01258pgm_1
(0.0e+00)
HMMTigr

Transmembrane TMHMM 2.0

Source http://www.cbs.dtu.dk/services/TMHMM/

SignalP 3.0

Source http://www.cbs.dtu.dk/services/SignalP/

MRNA

atgtacaagctggtacttgtccgccacggacaaagcacatggaatctggaaaaccggttcaccggctggaccgatgtgga
tctgaccccgctgggcgaaaccgaagcccgcgaaggcgcacgtctgatagccgcagcgggccttacctttgacgaatgcc
atacctcggtgctcaagcgggccatacgcaccctgaacatcatacaggaagagctggacctgctgtggctgcctgtgcac
cgccactggcggctcaacgagcgccactacggcgcgctgcagggactgaataaaaaagaaatgtcggaaaaatacggcga
ggaacaggtattcatctggcggcgcagctttgacacaccgccccctgcccttaccgccgacgacccgcgccaccccgcgc
atgaccggcggtacgcctcgctgacagcccgtcagatgccgctgtgcgaaagccttaaagacaccgtggccagagtgctg
ccatactggcacgaaacccttgctccggccatacaggccggccgccgcctgctggtggccgcacacggcaacagtctgcg
ggcgctcgtcatgcaccttgacggcatgtcgccagacgaagtcacggggctgaacattcccaccgggctgccgctggtgt
acgaactggacagtaatcttacaccgctgcggcgcgcgtatctgggtgatgccgaagccgccgaggcaaaagccagagcc
gttgccgaacaggcaaaggctggaacaacggaacgcccgtga

-
SiteMap      Feedback      Biosciences Division      ORNL     Disclaimer     Webmaster